PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_76835g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 426aa    MW: 47178.4 Da    PI: 6.8668
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_76835g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.8e-091091461954
                    HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    Fe   ++yp+ +++  LA++ gLt +qV++WF N R +
  MA_76835g0010 109 FEHflHPYPKDADKHMLARQAGLTRSQVSNWFINARVR 146
                    554459******************************88 PP

2BELL66.84.4e-221433072
           BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                   +q+v+ssFe+v+g g+ak YtslAl +iSrhFrcL+dai++qi
  MA_76835g0010  1 MQIVVSSFETVTGFGTAKTYTSLALGTISRHFRCLRDAIVGQI 43
                   9*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.4E-16140IPR006563POX domain
PROSITE profilePS5007111.87287150IPR001356Homeobox domain
CDDcd000861.18E-1190151No hitNo description
SMARTSM003894.5E-890154IPR001356Homeobox domain
SuperFamilySSF466891.84E-1691157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-2893156IPR009057Homeodomain-like
PfamPF059209.6E-18107146IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MQIVVSSFET VTGFGTAKTY TSLALGTISR HFRCLRDAIV GQICVSSKSL GEEDMAGNGK  60
GETSRLRFVD QQLRQQRALQ QLGMIQQPAW RPQRGLPERA VSVLRAWLFE HFLHPYPKDA  120
DKHMLARQAG LTRSQVSNWF INARVRLWKP MVEEIYMEEM KEAELGHSSA EKDYRKSGDS  180
KEDTKSEEGS ENSQNSEDQK HTKTTHLDSN AQDVVCEQQN ISVSSGLKSE HSPDMRYGRS  240
QAFSIEGLSN DELFHEVRDE GVTPGKLKKA RNGIEGSTYH LSPNMSTAVD FKMEGSCQNG  300
KFNDERHSSE NYILVHSGMA LADSSGSSGS YQIGCLNRYG QEAFTPKFSG SGGVSLTLGL  360
QHSDGLSLSG TQQRCISSEG RNHGLGSVSH DYCNISETAA AHAANAYESI NLENRKRFAT  420
HLLQTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-1796153158Homeobox protein Meis1
4xrs_B4e-1796153158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1137230.0BT113723.1 Picea glauca clone GQ03418_I09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059079.11e-117PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0C9RM181e-177A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
STRINGPOPTR_0006s21950.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-71BEL1-like homeodomain 1